Distribution of free and bound phenolic compounds, and alkylresorcinols in wheat aleurone enriched fractions

Untargeted metabolomic examine milk and ruminal fluid of Holstein cows supplemented with Perilla frutescens leaf

Milk compounds are vital for human nutrient necessities and well being. The ruminal metabolic profile is liable for dietary diet and determines milk manufacturing. Perilla frutescens leaf (PFL) is a generally used medicinal herb resulting from its bioactive metabolites. This examine elucidated the results of PFL on the metabolome of two biofluids (rumen fluid and milk) of 14 cows fed a primary whole blended ration food regimen (CON, n = 7) and supplemented with 300 g/d PFL per cow (PFL, n = 7) by ultra-performance liquid chromatography coupled to quadrupole time-of-flight mass spectrometry. Milk PE-NMe and DG, oleanolic acid, and nucleotides had been upregulated, and milk medium-chain fatty acids (2-hydroxycaprylic acid) had been down-regulated in response to PFL. The supplementation of PFL elevated the abundance of pyrimidine nucleotides each in rumen fluid and milk.

Rat/Canine Angiotensin I, pure (bioactive)
AT56-P-1	Alpha Diagnostics	1 mg	EUR 286

DiscoveryProbe? Bioactive Compound Library
L1022-.25	ApexBio	250 uL/well(10 mM solution)	EUR 42042

DiscoveryProbe? Bioactive Compound Library
L1022-5	ApexBio	5 mg/well	EUR 54686

Human Angiotensin II (1-4), pure (bioactive)
AT66-P-5	Alpha Diagnostics	5 mg	EUR 286

Human Angiotensin I, pure (bioactive)
AT55-P-5	Alpha Diagnostics	5 mg	EUR 529

Human Angiotensin II, pure (bioactive)
AT65-P-5	Alpha Diagnostics	5 mg	EUR 286

Human Angiotensin III, pure (bioactive)
AT75-P-5	Alpha Diagnostics	5 mg	EUR 286

GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein
PROTP01275-1	BosterBio	Regular: 50ug	EUR 317
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.

Amyloid ?-Peptide (1-42) (human)
B6057-.1	ApexBio	100 ug	EUR 276

HIV-1 Tat Protein Peptide
B1433-1	ApexBio	1 mg	EUR 128
Description: HIV-1 Tat Protein Peptide

Lytic Peptide, Shiva ? 1
SP-88327-1	Alpha Diagnostics	1 mg	EUR 347

Brain natriuretic peptide (1-32) (human)
B5442-1	ApexBio	1 mg	EUR 518

Amyloid Beta-Peptide (1-40) (human)
A1124-1	ApexBio	1 mg	EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

YAP-TEAD Inhibitor 1 (Peptide 17)
A1149-1	ApexBio	1 mg	EUR 235

Human Angiotensin II (3-8), pure (bioactive)
AT67-P-5	Alpha Diagnostics	5 mg	EUR 286

Human Angiotensin II (4-8), pure (bioactive)
AT68-P-5	Alpha Diagnostics	5 mg	EUR 286

Human Angiotensin II (5-8), pure (bioactive)
AT69-P-5	Alpha Diagnostics	5 mg	EUR 286

ENTPD3 Human, Ectonucleoside Triphosphate Diphosphohydrolase 3 Human Recombinant Protein, sf9 Bioactive
PROTO75355-2	BosterBio	Regular: 4ug	EUR 317
Description: ENTPD3 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 451 amino acids (44-485a.a.) and having a molecular mass of 50.7kDa (Molecular size on SDS-PAGE will appear at approximately 50-70kDa).;ENTPD3 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.

GnRH Associated Peptide (GAP) (1-13), human
A1020-1	ApexBio	1 mg	EUR 90
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

SAMS Peptide
B5097-1	ApexBio	1 mg	EUR 222

Rhodopsin peptide
A1087-1	ApexBio	1 mg	EUR 131
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light.

Human Hepcidine-25 bioactive(Hepc-25) ELISA Kit
QY-E05472	Qayee Biotechnology	96T	EUR 361

Canine C-Peptide ELISA Kit
DLR-C-Peptide-c-48T	DL Develop	48T	EUR 527
Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit
DLR-C-Peptide-c-96T	DL Develop	96T	EUR 688
Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-48T	DL Develop	48T	EUR 398
Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-96T	DL Develop	96T	EUR 511
Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-48T	DL Develop	48T	EUR 450
Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-96T	DL Develop	96T	EUR 582
Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-48T	DL Develop	48T	EUR 467
Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-96T	DL Develop	96T	EUR 605
Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit
RD-C-Peptide-c-48Tests	Reddot Biotech	48 Tests	EUR 533

Canine C-Peptide ELISA Kit
RD-C-Peptide-c-96Tests	Reddot Biotech	96 Tests	EUR 740

Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-48Tests	Reddot Biotech	48 Tests	EUR 387

Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-96Tests	Reddot Biotech	96 Tests	EUR 532

Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-48Tests	Reddot Biotech	48 Tests	EUR 446

Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-96Tests	Reddot Biotech	96 Tests	EUR 615

Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-48Tests	Reddot Biotech	48 Tests	EUR 465

Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-96Tests	Reddot Biotech	96 Tests	EUR 643

Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-48Tests	Reddot Biotech	48 Tests	EUR 557

Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-96Tests	Reddot Biotech	96 Tests	EUR 774

Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-48Tests	Reddot Biotech	48 Tests	EUR 404

Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-96Tests	Reddot Biotech	96 Tests	EUR 556

Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-48Tests	Reddot Biotech	48 Tests	EUR 465

Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-96Tests	Reddot Biotech	96 Tests	EUR 643

Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-48Tests	Reddot Biotech	48 Tests	EUR 486

Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-96Tests	Reddot Biotech	96 Tests	EUR 672

Atrial Natriuretic Peptide (1-28), Rat
SP-55278-1	Alpha Diagnostics	0.5 mg	EUR 286

C-type natriuretic peptide (1-22) (human, rat, swine)
B5441-1	ApexBio	1 mg	EUR 276

Eledoisin-Related Peptide
B5233-1	ApexBio	1 mg	EUR 155

MLCK inhibitor peptide
B5236-1	ApexBio	1 mg	EUR 184

Lyn peptide inhibitor
B5285-1	ApexBio	1 mg	EUR 601

Compstatin control peptide
B5478-1	ApexBio	1 mg	EUR 373

c-JUN peptide
B9007-1	ApexBio	1 mg	EUR 312

Cadherin Peptide, avian
A1028-1	ApexBio	1 mg	EUR 102
Description: Cadherin Peptide, avian, (C44H75N17O13), a peptide with the sequence Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-NH2, MW= 1050.2. Cadherins (named for "calcium-dependent adhesion") are a class of type-1 transmembrane proteins.

Dynamin inhibitory peptide
A1046-1	ApexBio	1 mg	EUR 189
Description: Dynamin Inhibitory Peptide is a peptide (Gln-Val-Pro-Ser-Arg-Pro-Asn-Arg-Ala-Pro) inhibitor of the GTPase dynamin.Dynamin is a 100-kDa large GTPase that functions to tabulate membranes and liberate nascent vesicles from the Golgi apparatus and plasma membrane.

DAPK Substrate Peptide
A4469-1	ApexBio	1 mg	EUR 292
Description: Synthetic peptide substrate for death associated protein kinase (DAPK) (Km = 9 ?M).

Calcineurin Autoinhibitory Peptide
A4532-1	ApexBio	1 mg	EUR 399
Description: Selective inhibitor of Ca2+-calmodulin-dependent protein phosphatase (calcineurin) (IC50 ~ 10 mM). Does not inhibit PP1, PP2A or CaM kinase II (IC50 > 100 mM).

Histone H2A Peptide
7145-1	Biovision		EUR 175

Histone H2B Peptide
7146-1	Biovision		EUR 175

IGF-1, human recombinant
P1016-.1	ApexBio	100 µg	EUR 763
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue

Gastrin Releasing Peptide (GRP) (1-16) (porcine)
SP-100261-1	Alpha Diagnostics	1 mg	EUR 164

Human LILRB4/ CD85k/ ILT3 Bioactive Protein, Fc, Human-100ug
QP2848-100ug	EnQuireBio	100ug	EUR 563

Human LILRB4/ CD85k/ ILT3 Bioactive Protein, His, Yeast-20ug
QP2848-20ug	EnQuireBio	20ug	EUR 245

Human/Rat/Mouse PLP104-117 peptide, depalmitoylated
PLP104-1-1	Alpha Diagnostics	1 mg	EUR 141

Human/Rat/Mouse PLP178-191 peptide, depalmitoylated
PLP178-1-1	Alpha Diagnostics	1 mg	EUR 141

Human/Rat/Mouse PLP40-59 peptide, depalmitoylated
PLP40-1-1	Alpha Diagnostics	1 mg	EUR 141

G-Protein antagonist peptide
B6889-1	ApexBio	1 mg	EUR 366

Akt/SKG Substrate Peptide
B5101-1	ApexBio	1 mg	EUR 350

MLCK inhibitor peptide 18
B5211-1	ApexBio	1 mg	EUR 116

PDZ1 Domain inhibitor peptide
B5271-1	ApexBio	1 mg	EUR 438

Urotensin II-related peptide
B5272-1	ApexBio	1 mg	EUR 273

Thrombin Receptor Agonist Peptide
A8668-1	ApexBio	1 mg	EUR 200
Description: Agonist at the thrombin receptor; causes platelet aggregation (EC50 = 4 ?M) and secretion.

Rat renin inhibitor peptide
2557-1	Biovision		EUR 229

Calcitonin, Human (Synthetic peptide)
P1433-1	Biovision		EUR 185

IL-1 beta, rat recombinant
P1019-1	ApexBio	1 mg	EUR 7288
Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties.

ApoA-1, human recombinant protein
P1052-.1	ApexBio	100 µg	EUR 313
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

ApoA-1, human recombinant protein
P1052-1	ApexBio	1 mg	EUR 1553
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

WNT-1, human recombinant protein
P1068-1	ApexBio	1 mg	EUR 6940
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Recombinant Human Gremlin-1 Protein
PROTO60565-1	BosterBio	50ug	EUR 317
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle.  Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7.  It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3  kDa protein containing 160 amino acid residues.

Recombinant Human Galectin-1 Protein
PROTP09382-1	BosterBio	50ug	EUR 317
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.

Recombinant Human PECAM-1 Protein
PROTP16284-1	BosterBio	50ug	EUR 317
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions

Canine IGF-1 Recombinant Protein
R00148-1	BosterBio	5ug/vial	EUR 259
Description: Insulin-like growth factor 1 (IGF-1) is a primary mediator of the effects of growth hormone (GH) and has growth-promoting effects on almost every cell in the body. IGF-1 can also regulate cell growth and development, especially in nerve cells, as well as cellular DNA synthesis. Canine IGF-1 Recombinant Protein is purified insulin-like growth factor 1 (IGF-1) produced in yeast.

Recombinant Human ANG-1 Protein
PROTQ15389-1	BosterBio	20ug	EUR 317
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.

Recombinant Murine Cardiotrophin-1 Protein
PROTQ60753-1	BosterBio	10ug	EUR 317
Description: CT-1 is a member of the IL-6 family of cytokines which also includes LIF, CNTF, OSM (Oncostatin M), IL-11, IL-6 and possibly NNT-1/BCSF-3. CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung and signals through the LIF receptor and the gp130 receptor subunit. CT-1 has the ability to induce cardiac myocyte hypertrophy, and enhances the survival of cardiomyocyte and different neuronal populations. Recombinant murine Cardiotrophin-1 is a 21.3 kDa protein consisting of 202 amino acid residues.

RFDS peptide
SP-52304-1	Alpha Diagnostics	5 mg	EUR 141

RGD peptide
SP-52305-1	Alpha Diagnostics	5 mg	EUR 164

RGDV peptide
SP-52307-1	Alpha Diagnostics	5 mg	EUR 141

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein
P1054-1	ApexBio	1 mg	EUR 3947
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

IL-1-beta Interleukin-1 betaHuman Recombinant Protein
PROTP01584-1	BosterBio	Regular: 10ug	EUR 317
Description: Interleukin-1 beta Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17000 Dalton.;The IL-1b is purified by proprietary chromatographic techniques.

MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein
PROTP03956-1	BosterBio	Regular: 20ug	EUR 317
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.

Human/Rat/Mouse PLP139-151 (S140) peptide, depalmitoylated
PLP139-1-1	Alpha Diagnostics	1 mg	EUR 141

(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein
PROTO75771-1	BosterBio	Regular: 10ug	EUR 317
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

JE (MCP-1), murine recombinant protein
P1034-1	ApexBio	1 mg	EUR 3878
Description: JE (MCP-1), also known as chemokine (C-C motif) ligand 2 (CCL2), is a member of the CC chemokine family that is a chemotactic agent for mononuclear cells.

IFN-alpha 1, human recombinant protein
P1058-.1	ApexBio	100 µg	EUR 313
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.

IFN-alpha 1, human recombinant protein
P1058-1	ApexBio	1 mg	EUR 2277
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.

OryzaExp? IGF-1 LR3, Human Recombinant
P1399-1	Biovision		EUR 881

Recombinant Human sTRAIL Receptor-1 Protein
PROTO00220-1	BosterBio	50ug	EUR 317
Description: TRAIL Receptor-1/DR4 and TRAIL Receptor-2/DR5 belong to the TNFR superfamily of transmembrane proteins and contain a cytoplasmic "death domain, " which can activate the cell's apoptotic machinery. These receptors are activated by binding to either membrane anchored or soluble TRAIL/Apo2L. Recombinant human soluble TRAIL Receptor-1/DR4 is a 22.7 kDa protein (215 amino acid residues) consisting of the TNFR homologous, cysteine rich portion of the extracellular domain.

Recombinant Human LAG-1 (CCL4L1) Protein
PROTP13236-1	BosterBio	20ug	EUR 317
Description: LAG-1 is CC chemokine that signals through the CCR5 receptor. LAG-1 is identical to MIP-1β (ACT II isotype) except for two amino acid substitutions; arginine for histidine at position 22 and serine for glycine at position 47 of the mature protein. LAG-1 chemoattracts monocytes, and exhibits activity as an HIV suppressive factor. Recombinant human LAG-1 is a 7.7 kDa protein containing 69 amino acid residues.

NNT1 Neurotrophin-1 Human Recombinant Protein
PROTQ9UBD9-1	BosterBio	Regular: 10ug	EUR 317
Description: Neurotrophin-1 Human Recombinant (28-225) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 199 amino acids and having a molecular mass of 22kDa.;The NNT-1 is purified by proprietary chromatographic techniques.

HPSE Heparanase-1 Human Recombinant Protein
PROTQ9Y251-1	BosterBio	Regular: 20ug	EUR 317
Description: HPSE Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 531 amino acids (36-543 a.a) and having a molecular mass of 60kDa.;HPSE is fused to a 23 amino acid His-tag at N-terminus.

Recombinant Rat MCP-1 (CCL2) Protein
PROTP14844-1	BosterBio	10ug	EUR 317
Description: The MCP proteins belong to the CC chemokine family, and signal through CCR2 and, with the exception of MCP-1, other CCR receptors. The MCP proteins chemoattract and activate monocytes, activated T cells, basophils, NK cells, and immature dendritic cells. The MCP family cross reacts across species. Recombinant rat MCP-1 is a 14.0 kDa protein containing 125 amino acid residues including the four highly conserved cysteine residues present in the CC chemokines.

SDC1 Syndecan-1 Human Recombinant Protein
PROTP18827-1	BosterBio	Regular: 20ug	EUR 317
Description: SDC1 Human Recombinant produced in E. coli is a single polypeptide chain containing 262 amino acids (18-254) and having a molecular mass of 27kDa (molecular size on SDS-PAGE will appear higher).;SDC1 is fused to a 25 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

Canine IL-1 beta Recombinant Protein
R00101-1	BosterBio	5ug/vial	EUR 259
Description: IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Canine IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.

Canine IL-1 alpha Recombinant Protein
R01144-1	BosterBio	5ug/vial	EUR 259
Description: IL-1 alpha (IL-1α, IL-1F1) is a member of the interleukin 1 family of cytokines. IL-1 alpha is an inflammatory cytokine active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. Canine IL-1 alpha Recombinant Protein is purified interleukin-1 alpha cytokine produced in yeast.

Equine IFN beta 1 Recombinant Protein
R02041-1	BosterBio	5ug/vial	EUR 259
Description: IFN beta is a mammalian Type I inferferon, functionig as a regulator of cellular activity by interacting with cell-surface receptors and activating various signaling pathways. IFN beta produces antiviral, antibacterial, and anticancer properties. Equine IFN beta Recombinant Protein is purified IFN beta produced in yeast.

Recombinant Human Heregulin Beta -1 Protein
PROTQ02297-1	BosterBio	50ug	EUR 317
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).

CTF1 Cardiotrophin-1 Human Recombinant Protein
PROTQ16619-1	BosterBio	Regular: 10ug	EUR 317
Description: Cardiotrophin-1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 201 amino acids and having a molecular mass of 21.2kDa.;The CTF1 is purified by proprietary chromatographic techniques.

Recombinant Rat IL-1 Beta Protein
PROTQ63264-1	BosterBio	10ug	EUR 317
Description: IL-1β is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1α and IL-1β binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1β is a secreted cytokine, IL-1α is predominantly a cell-associated cytokine. Recombinant rat IL-1β is a 17.4 kDa protein containing 153 amino acid residues.

Norovirus Group-1 Capsid Recombinant Protein
PROTQ83884-1	BosterBio	Regular: 0.5mg	EUR 788
Description: The Recombinant Norovirus Group-1 Capsid, E.Coli derived, is a positive sense RNA virus with 7.5kb nucleotides, encoding a major structural protein VP1 with 58~60kDa and a VP2 protein. The full length of VP1 capsid protein is derived from the group 1 Norwalk virus. The protein is fused to a 6 His tag at N-terminal and purified by chromatography techniques.

Autocamtide-2-related inhibitory peptide
B6831-1	ApexBio	1 mg	EUR 154
Description: IC50: 40 nM for CaM-kinase II [1].

Rac1 Inhibitor F56, control peptide
B5275-1	ApexBio	1 mg	EUR 399

Anti-Peptide YY/PYY Antibody
A04223-1	BosterBio	100ug/vial	EUR 334

Amyloid ?-Peptide (10-20) (human)
A1038-1	ApexBio	1 mg	EUR 166
Description: The amyloid ?-peptide (A?) has a central role in initiating neurodegeneration in Alzheimer disease (AD) 1. It is widely believed to be an incidental catabolic byproduct of the amyloid ? protein precursor (APP) with no normal physiological function.

Amyloid ?-peptide (10-35), amide
A1102-1	ApexBio	1 mg	EUR 131
Description: Amyloid ?-protein (10-35) was used as a trunCated peptide model for the full-length amyloid ?-proteins (1-40) and (1-42) in high-resolution structural studies. In contrast to the full-length amyloid ?-proteins, amyloid ?-protein (10-35) allowed the contro

Cdk2/Cyclin Inhibitory Peptide I
A1107-1	ApexBio	1 mg	EUR 96
Description: Cyclin-dependent kinase 2 also known as cell division protein kinase 2(1). The protein encoded by this gene is a member of the cyclin-dependent kinase family of Ser/Thr protein kinases.

S6 Kinase Substrate Peptide 32
A1118-1	ApexBio	1 mg	EUR 166
Description: Peptide that measures the activity of kinases that phosphorylate ribosomal protein S6. It can also be used as a substrate.

Amyloid Precursor C-Terminal Peptide
A1004-1	ApexBio	1 mg	EUR 113
Description: Amyloid precursor c-terminal peptide (APP) (C86H118N20O27S) has the amino acid sequence Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn. Although it has been implicated as a regulator of synapse formation, neural plasticity and iron export, the primary function of APP is not known.

Bax inhibitor peptide, negative control
A4462-1	ApexBio	1 mg	EUR 340
Description: Negative control peptide for the Bax inhibitor peptides V5 and P5 , which inhibit Bax translocation to mitochondria and Bax-mediated apoptosis in vitro.

Histone H3 Peptide, biotin conjugate
7143-1	Biovision		EUR 1132

Stat3 Peptide Inhibitor, Cell-Permeable
1778-1	Biovision		EUR 229

Histone H3 Peptide-Biotin Conjugate
2233-1	Biovision		EUR 1132

Custom Peptide Synthesis order form
Pepord-1	Alpha Diagnostics	1	Ask for price

Envelope-1, Dengue Virus Subtype 1 Recombinant Protein, Insect Cells
PROTB1PNJ5-1	BosterBio	Regular: 10ug	EUR 317
Description: Recombinant Dengue Virus Subtype 1 produced in Insect Cells is a polypeptide chain containing amino acids 281-675 and having a molecular weight of approximately 50kDa. ;Dengue Envelope-1 is purified by proprietary chromatographic technique.

MCP-1 Monocyte Chemotactic Protein-1 Mouse Recombinant Protein (CCL2)
PROTP10148-1	BosterBio	Regular: 10ug	EUR 317
Description: Monocyte Chemotactic Protein-1 Mouse Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 125 amino acids and having a molecular mass of 14 kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.

MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)
PROTP13500-1	BosterBio	Regular: 20ug	EUR 317
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.

GAD1 iso1 Glutamate Decarboxylase 1 Isoform-1 Human Recombinant Protein
PROTQ99259-1	BosterBio	Regular: 20ug	EUR 317
Description: GAD1 iso1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 617 amino acids (1-594 a.a) and having a molecular mass of 69.3kDa. GAD1 iso1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

BCA-1/BLC Human Recombinant Protein (CXCL13)
PROTO43927-1	BosterBio	Regular: 20ug	EUR 317
Description: CXCL13 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 87 amino acids and having a molecular mass of 10.3 kDa. ;The BCA-1 is purified by proprietary chromatographic techniques.

Recombinant Murine BCA-1/BLC (CXCL13) Protein
PROTO55038-1	BosterBio	20ug	EUR 317
Description: BCA-1/BLC, a CXC chemokine, is expressed in the liver, spleen, lymph nodes, appendix and stomach. It exerts its activities through its only receptor CXCR5. BCA-1/BLC is a potent chemoattractant for B lymphocytes and induces weak chemotactic response in T cells and macrophages. It manifests no activity on neutrophils and monocytes. Recombinant murine BLC is a 9.8 kDa protein containing 88 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.

SOD1 Superoxide Dismutase 1 Human Recombinant Protein
PROTP00441-1	BosterBio	Regular: 25ug	EUR 317
Description: Recombinant Human Cu/Zn Superoxide Dismutase produced in E.Coli is a single monomeric non-glycosylated polypeptide chain containing 154 amino acids and having a total molecular mass of 15.9 kDa.;The SOD1 is purified by proprietary chromatographic techniques.

AMBP Alpha-1 Microglobulin Human Recombinant Protein
PROTP02760-1	BosterBio	Regular: 10ug	EUR 317
Description: AMBP Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 205 amino acids (20-203) and having a molecular mass of 23.1 kDa.;AMBP is fused to a 21 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

Recombinant Rat SDF-1 Alpha (CXCL12) Protein
PROTQ9QZD1-1	BosterBio	10ug	EUR 317
Description: SDF-1α and β are stromal derived CXC chemokines, and signal through the CXCR4 receptor. SDF-1α and β chemoattract B and T cells, and have been shown to induce migration of CD34+ stem cells. Additionally, the SDF-1 proteins exert HIV suppressive activity in cells expressing the CXCR4 receptor. Recombinant rat SDF-1α is a 7.9 kDa protein containing 68 amino acid residues.

RSPO1 R-Spondin-1 Mouse Recombinant Protein
PROTQ9Z132-1	BosterBio	Regular: 10ug	EUR 317
Description: RSPO1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 254 amino acids (21-265a.a.) and having a molecular mass of 28.2kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa). RSPO1 is expressed with an 9 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.

The pathways of pyrimidine metabolism and biosynthesis of unsaturated fatty acids had been enriched each in the rumen fluid and milk. We additionally discovered the milk 2-hydroxycaprylic acid was positively correlated with ruminal uridine 5-monophosphate, and was negatively correlated with ruminal deoxycytidine, and the milk thymidine was positively correlated with ruminal icosenoic acid. This examine discovered that the supplementation of PFL may alter the ruminal metabolic profiles and milk synthesis via regulation of the pathways of pyrimidine metabolism and biosynthesis of unsaturated fatty acids. Our new findings present complete insights into the metabolomics profile of rumen fluid and milk, supporting the potential manufacturing of Perilla frutescens milk in dairy cows.