Several firms have centered their consideration on the event of applied sciences capable of enrich/isolate the wheat aleuronic layer as a result of it’s a supply of bioactive compounds. In this work two completely different wheat bran fractions enriched in aleurone (AF1, 55-70% aleurone and AF2, 75-90% aleurone) had been obtained by a dry fractionation primarily based on air classification. Free and bound phenolic compounds, and alkylresorcinols had been decided in the 2 fractions by HPLC-DAD-ESI-TOF-MS and GC-MS, respectively. To our information, feruloyl di-hexoside was described for the primary time in wheat aleurone and flavonoids had been quantified for the primary time in this fraction. The outcomes have proven that essentially the most concentrated free phenolic compounds had been flavonoids, and AF1 was the fraction that introduced the very best flavonoid content material; whereas trans ferulic acid was essentially the most plentiful bound phenolic acid, which highest content material was obtained in AF2.
Besides, whole content material of ferulic acid monomers in AF2 was 33.63% greater than in AF1, whereas whole content material of ferulic acid dimers/trimers in AF1 was 33.9% greater than in AF2. The highest content material of alkylresorcinols was obtained in AF1 and it was 10.30% greater than the obtained in AF2. Therefore, it may be said that this inexperienced know-how could possibly be used to provide enriched aleurone fractions as supply of phenolic and alkylresorcinol compounds. These fractions could possibly be of nice curiosity for the formulation of enriched meals.Current consciousness about the advantages of a balanced food regimen helps ongoing developments in people in direction of a more healthy food regimen. This evaluation supplies an outline of fruits and fruit-by merchandise as sources of bioactive compounds and their extraction methods, and the use of lactic acid fermentation of fruit juices to extend their performance.
Fruit matrices emerge as a technological different to be fermented by autochthonous or allochthonous lactic acid micro organism (LAB similar to Lactiplantibacillus plantarum, Lacticaseibacillus rhamnosus, and different Lactobacillus species), and additionally as probiotic automobiles. During fermentation, microbial enzymes act on a number of fruit phytochemicals producing new derived compounds with affect on the aroma and the performance of the fermented drinks. Moreover, fermentation considerably reduces the sugar content material bettering their dietary worth and extending the shelf-life of fruit-based drinks.
Biopolymers and nanostructured supplies to develop pectinases-based immobilized nano-biocatalytic techniques for biotechnological functions
Pectinases are the rising enzymes of the biotechnology business with a 25% share in the worldwide meals and beverage enzyme market. These are inexperienced and eco-friendly instruments of nature and maintain a outstanding place among the many commercially produced enzymes. Pectinases exhibit functions in varied industrial bioprocesses, similar to clarification of fruit juices and wine, degumming, and retting of plant fibers, extraction of antioxidants and oil, fermentation of tea/espresso, wastewater remediation, modification of pectin-laden agro-industrial waste supplies for high-value merchandise biosynthesis, manufacture of cellulose fibres, scouring, bleaching, and measurement discount of material, cellulosic biomass pretreatment for bioethanol manufacturing, and so forth. Nevertheless, like different enzymes, pectinases additionally face the challenges of low operational stability, recoverability, and recyclability.
To tackle the above-mentioned issues, enzyme immobilization has grow to be an eminently promising strategy to enhance their thermal stability and catalytic traits. Immobilization facilitates simple restoration and recycling of the biocatalysts a number of instances, resulting in enhanced efficiency and business feasibility.In this evaluation, we illustrate current developments on the immobilization of pectinolytic enzymes utilizing polymers and nanostructured materials-based provider helps to represent novel biocatalytic techniques for industrial exploitability.
The first part reviewed the immobilization of pectinases on polymers-based helps (ca-alginate, chitosan, agar-agar, hybrid polymers) as a number matrix to assemble strong pectinases-based biocatalytic techniques. The second half covers nanostructured helps (nano-silica, magnetic nanostructures, hybrid nanoflowers, dual-responsive polymeric nanocarriers, montmorillonite clay), and cross-linked enzyme aggregates for enzyme immobilization. The biotechnological functions of the resulted immobilized strong pectinases-based biocatalytic techniques are additionally meticulously vetted. Finally, the concluding remarks and future suggestions are additionally given.

Untargeted metabolomic examine milk and ruminal fluid of Holstein cows supplemented with Perilla frutescens leaf
Milk compounds are vital for human nutrient necessities and well being. The ruminal metabolic profile is liable for dietary diet and determines milk manufacturing. Perilla frutescens leaf (PFL) is a generally used medicinal herb resulting from its bioactive metabolites. This examine elucidated the results of PFL on the metabolome of two biofluids (rumen fluid and milk) of 14 cows fed a primary whole blended ration food regimen (CON, n = 7) and supplemented with 300 g/d PFL per cow (PFL, n = 7) by ultra-performance liquid chromatography coupled to quadrupole time-of-flight mass spectrometry. Milk PE-NMe and DG, oleanolic acid, and nucleotides had been upregulated, and milk medium-chain fatty acids (2-hydroxycaprylic acid) had been down-regulated in response to PFL. The supplementation of PFL elevated the abundance of pyrimidine nucleotides each in rumen fluid and milk.
GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein |
PROTP01275-1 |
BosterBio |
Regular: 50ug |
EUR 317 |
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques. |
Amyloid ?-Peptide (1-42) (human) |
B6057-.1 |
ApexBio |
100 ug |
EUR 276 |
HIV-1 Tat Protein Peptide |
B1433-1 |
ApexBio |
1 mg |
EUR 128 |
Description: HIV-1 Tat Protein Peptide |
ENTPD3 Human, Ectonucleoside Triphosphate Diphosphohydrolase 3 Human Recombinant Protein, sf9 Bioactive |
PROTO75355-2 |
BosterBio |
Regular: 4ug |
EUR 317 |
Description: ENTPD3 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 451 amino acids (44-485a.a.) and having a molecular mass of 50.7kDa (Molecular size on SDS-PAGE will appear at approximately 50-70kDa).;ENTPD3 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques. |
Brain natriuretic peptide (1-32) (human) |
B5442-1 |
ApexBio |
1 mg |
EUR 518 |
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
YAP-TEAD Inhibitor 1 (Peptide 17) |
A1149-1 |
ApexBio |
1 mg |
EUR 235 |
GnRH Associated Peptide (GAP) (1-13), human |
A1020-1 |
ApexBio |
1 mg |
EUR 90 |
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP). |
Canine C-Peptide ELISA Kit |
RD-C-Peptide-c-48Tests |
Reddot Biotech |
48 Tests |
EUR 533 |
Canine C-Peptide ELISA Kit |
RD-C-Peptide-c-96Tests |
Reddot Biotech |
96 Tests |
EUR 740 |
Human C-Peptide ELISA Kit |
RD-C-Peptide-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 387 |
Human C-Peptide ELISA Kit |
RD-C-Peptide-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 532 |
Mouse C-Peptide ELISA Kit |
RD-C-Peptide-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 446 |
Mouse C-Peptide ELISA Kit |
RD-C-Peptide-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 615 |
Rat C-Peptide ELISA Kit |
RD-C-Peptide-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 465 |
Rat C-Peptide ELISA Kit |
RD-C-Peptide-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 643 |
Canine C-Peptide ELISA Kit |
DLR-C-Peptide-c-48T |
DL Develop |
48T |
EUR 527 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine C-Peptide ELISA Kit |
DLR-C-Peptide-c-96T |
DL Develop |
96T |
EUR 688 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human C-Peptide ELISA Kit |
DLR-C-Peptide-Hu-48T |
DL Develop |
48T |
EUR 398 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human C-Peptide ELISA Kit |
DLR-C-Peptide-Hu-96T |
DL Develop |
96T |
EUR 511 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse C-Peptide ELISA Kit |
DLR-C-Peptide-Mu-48T |
DL Develop |
48T |
EUR 450 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse C-Peptide ELISA Kit |
DLR-C-Peptide-Mu-96T |
DL Develop |
96T |
EUR 582 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat C-Peptide ELISA Kit |
DLR-C-Peptide-Ra-48T |
DL Develop |
48T |
EUR 467 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat C-Peptide ELISA Kit |
DLR-C-Peptide-Ra-96T |
DL Develop |
96T |
EUR 605 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine C-Peptide ELISA Kit |
RDR-C-Peptide-c-48Tests |
Reddot Biotech |
48 Tests |
EUR 557 |
Canine C-Peptide ELISA Kit |
RDR-C-Peptide-c-96Tests |
Reddot Biotech |
96 Tests |
EUR 774 |
Human C-Peptide ELISA Kit |
RDR-C-Peptide-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 404 |
Human C-Peptide ELISA Kit |
RDR-C-Peptide-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 556 |
Mouse C-Peptide ELISA Kit |
RDR-C-Peptide-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 465 |
Mouse C-Peptide ELISA Kit |
RDR-C-Peptide-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 643 |
Rat C-Peptide ELISA Kit |
RDR-C-Peptide-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 486 |
Rat C-Peptide ELISA Kit |
RDR-C-Peptide-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 672 |
IGF-1, human recombinant |
P1016-.1 |
ApexBio |
100 µg |
EUR 763 |
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue |
SAMS Peptide |
B5097-1 |
ApexBio |
1 mg |
EUR 222 |
Rhodopsin peptide |
A1087-1 |
ApexBio |
1 mg |
EUR 131 |
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light. |
Human LILRB4/ CD85k/ ILT3 Bioactive Protein, Fc, Human-100ug |
QP2848-100ug |
EnQuireBio |
100ug |
EUR 563 |
Human LILRB4/ CD85k/ ILT3 Bioactive Protein, His, Yeast-20ug |
QP2848-20ug |
EnQuireBio |
20ug |
EUR 245 |
C-type natriuretic peptide (1-22) (human, rat, swine) |
B5441-1 |
ApexBio |
1 mg |
EUR 276 |
Recombinant Human ANG-1 Protein |
PROTQ15389-1 |
BosterBio |
20ug |
EUR 317 |
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein. |
Recombinant Murine Cardiotrophin-1 Protein |
PROTQ60753-1 |
BosterBio |
10ug |
EUR 317 |
Description: CT-1 is a member of the IL-6 family of cytokines which also includes LIF, CNTF, OSM (Oncostatin M), IL-11, IL-6 and possibly NNT-1/BCSF-3. CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung and signals through the LIF receptor and the gp130 receptor subunit. CT-1 has the ability to induce cardiac myocyte hypertrophy, and enhances the survival of cardiomyocyte and different neuronal populations. Recombinant murine Cardiotrophin-1 is a 21.3 kDa protein consisting of 202 amino acid residues. |
Recombinant Human Galectin-1 Protein |
PROTP09382-1 |
BosterBio |
50ug |
EUR 317 |
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues. |
Recombinant Human PECAM-1 Protein |
PROTP16284-1 |
BosterBio |
50ug |
EUR 317 |
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions |
Canine IGF-1 Recombinant Protein |
R00148-1 |
BosterBio |
5ug/vial |
EUR 259 |
Description: Insulin-like growth factor 1 (IGF-1) is a primary mediator of the effects of growth hormone (GH) and has growth-promoting effects on almost every cell in the body. IGF-1 can also regulate cell growth and development, especially in nerve cells, as well as cellular DNA synthesis. Canine IGF-1 Recombinant Protein is purified insulin-like growth factor 1 (IGF-1) produced in yeast. |
Recombinant Human Gremlin-1 Protein |
PROTO60565-1 |
BosterBio |
50ug |
EUR 317 |
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle. Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7. It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3 kDa protein containing 160 amino acid residues. |
IL-1 beta, rat recombinant |
P1019-1 |
ApexBio |
1 mg |
EUR 7288 |
Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties. |
ApoA-1, human recombinant protein |
P1052-.1 |
ApexBio |
100 µg |
EUR 313 |
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion. |
ApoA-1, human recombinant protein |
P1052-1 |
ApexBio |
1 mg |
EUR 1553 |
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion. |
WNT-1, human recombinant protein |
P1068-1 |
ApexBio |
1 mg |
EUR 6940 |
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. |
Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein |
P1054-1 |
ApexBio |
1 mg |
EUR 3947 |
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation |
IL-1-beta Interleukin-1 betaHuman Recombinant Protein |
PROTP01584-1 |
BosterBio |
Regular: 10ug |
EUR 317 |
Description: Interleukin-1 beta Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17000 Dalton.;The IL-1b is purified by proprietary chromatographic techniques. |
MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein |
PROTP03956-1 |
BosterBio |
Regular: 20ug |
EUR 317 |
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus. |
Eledoisin-Related Peptide |
B5233-1 |
ApexBio |
1 mg |
EUR 155 |
MLCK inhibitor peptide |
B5236-1 |
ApexBio |
1 mg |
EUR 184 |
Lyn peptide inhibitor |
B5285-1 |
ApexBio |
1 mg |
EUR 601 |
Compstatin control peptide |
B5478-1 |
ApexBio |
1 mg |
EUR 373 |
DAPK Substrate Peptide |
A4469-1 |
ApexBio |
1 mg |
EUR 292 |
Description: Synthetic peptide substrate for death associated protein kinase (DAPK) (Km = 9 ?M). |
Calcineurin Autoinhibitory Peptide |
A4532-1 |
ApexBio |
1 mg |
EUR 399 |
Description: Selective inhibitor of Ca2+-calmodulin-dependent protein phosphatase (calcineurin) (IC50 ~ 10 mM). Does not inhibit PP1, PP2A or CaM kinase II (IC50 > 100 mM). |
Cadherin Peptide, avian |
A1028-1 |
ApexBio |
1 mg |
EUR 102 |
Description: Cadherin Peptide, avian, (C44H75N17O13), a peptide with the sequence Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-NH2, MW= 1050.2. Cadherins (named for "calcium-dependent adhesion") are a class of type-1 transmembrane proteins. |
Dynamin inhibitory peptide |
A1046-1 |
ApexBio |
1 mg |
EUR 189 |
Description: Dynamin Inhibitory Peptide is a peptide (Gln-Val-Pro-Ser-Arg-Pro-Asn-Arg-Ala-Pro) inhibitor of the GTPase dynamin.Dynamin is a 100-kDa large GTPase that functions to tabulate membranes and liberate nascent vesicles from the Golgi apparatus and plasma membrane. |
c-JUN peptide |
B9007-1 |
ApexBio |
1 mg |
EUR 312 |
Gastrin Releasing Peptide (GRP) (1-16) (porcine) |
SP-100261-1 |
Alpha Diagnostics |
1 mg |
EUR 164 |
Human/Rat/Mouse PLP104-117 peptide, depalmitoylated |
PLP104-1-1 |
Alpha Diagnostics |
1 mg |
EUR 141 |
Human/Rat/Mouse PLP178-191 peptide, depalmitoylated |
PLP178-1-1 |
Alpha Diagnostics |
1 mg |
EUR 141 |
Human/Rat/Mouse PLP40-59 peptide, depalmitoylated |
PLP40-1-1 |
Alpha Diagnostics |
1 mg |
EUR 141 |
(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein |
PROTO75771-1 |
BosterBio |
Regular: 10ug |
EUR 317 |
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques. |
Recombinant Human Heregulin Beta -1 Protein |
PROTQ02297-1 |
BosterBio |
50ug |
EUR 317 |
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues). |
CTF1 Cardiotrophin-1 Human Recombinant Protein |
PROTQ16619-1 |
BosterBio |
Regular: 10ug |
EUR 317 |
Description: Cardiotrophin-1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 201 amino acids and having a molecular mass of 21.2kDa.;The CTF1 is purified by proprietary chromatographic techniques. |
Recombinant Rat IL-1 Beta Protein |
PROTQ63264-1 |
BosterBio |
10ug |
EUR 317 |
Description: IL-1β is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1α and IL-1β binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1β is a secreted cytokine, IL-1α is predominantly a cell-associated cytokine. Recombinant rat IL-1β is a 17.4 kDa protein containing 153 amino acid residues. |
Norovirus Group-1 Capsid Recombinant Protein |
PROTQ83884-1 |
BosterBio |
Regular: 0.5mg |
EUR 788 |
Description: The Recombinant Norovirus Group-1 Capsid, E.Coli derived, is a positive sense RNA virus with 7.5kb nucleotides, encoding a major structural protein VP1 with 58~60kDa and a VP2 protein. The full length of VP1 capsid protein is derived from the group 1 Norwalk virus. The protein is fused to a 6 His tag at N-terminal and purified by chromatography techniques. |
NNT1 Neurotrophin-1 Human Recombinant Protein |
PROTQ9UBD9-1 |
BosterBio |
Regular: 10ug |
EUR 317 |
Description: Neurotrophin-1 Human Recombinant (28-225) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 199 amino acids and having a molecular mass of 22kDa.;The NNT-1 is purified by proprietary chromatographic techniques. |
HPSE Heparanase-1 Human Recombinant Protein |
PROTQ9Y251-1 |
BosterBio |
Regular: 20ug |
EUR 317 |
Description: HPSE Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 531 amino acids (36-543 a.a) and having a molecular mass of 60kDa.;HPSE is fused to a 23 amino acid His-tag at N-terminus. |
Recombinant Human LAG-1 (CCL4L1) Protein |
PROTP13236-1 |
BosterBio |
20ug |
EUR 317 |
Description: LAG-1 is CC chemokine that signals through the CCR5 receptor. LAG-1 is identical to MIP-1β (ACT II isotype) except for two amino acid substitutions; arginine for histidine at position 22 and serine for glycine at position 47 of the mature protein. LAG-1 chemoattracts monocytes, and exhibits activity as an HIV suppressive factor. Recombinant human LAG-1 is a 7.7 kDa protein containing 69 amino acid residues. |
Recombinant Rat MCP-1 (CCL2) Protein |
PROTP14844-1 |
BosterBio |
10ug |
EUR 317 |
Description: The MCP proteins belong to the CC chemokine family, and signal through CCR2 and, with the exception of MCP-1, other CCR receptors. The MCP proteins chemoattract and activate monocytes, activated T cells, basophils, NK cells, and immature dendritic cells. The MCP family cross reacts across species. Recombinant rat MCP-1 is a 14.0 kDa protein containing 125 amino acid residues including the four highly conserved cysteine residues present in the CC chemokines. |
SDC1 Syndecan-1 Human Recombinant Protein |
PROTP18827-1 |
BosterBio |
Regular: 20ug |
EUR 317 |
Description: SDC1 Human Recombinant produced in E. coli is a single polypeptide chain containing 262 amino acids (18-254) and having a molecular mass of 27kDa (molecular size on SDS-PAGE will appear higher).;SDC1 is fused to a 25 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques. |
Canine IL-1 beta Recombinant Protein |
R00101-1 |
BosterBio |
5ug/vial |
EUR 259 |
Description: IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Canine IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast. |
Canine IL-1 alpha Recombinant Protein |
R01144-1 |
BosterBio |
5ug/vial |
EUR 259 |
Description: IL-1 alpha (IL-1α, IL-1F1) is a member of the interleukin 1 family of cytokines. IL-1 alpha is an inflammatory cytokine active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. Canine IL-1 alpha Recombinant Protein is purified interleukin-1 alpha cytokine produced in yeast. |
Equine IFN beta 1 Recombinant Protein |
R02041-1 |
BosterBio |
5ug/vial |
EUR 259 |
Description: IFN beta is a mammalian Type I inferferon, functionig as a regulator of cellular activity by interacting with cell-surface receptors and activating various signaling pathways. IFN beta produces antiviral, antibacterial, and anticancer properties. Equine IFN beta Recombinant Protein is purified IFN beta produced in yeast. |
Recombinant Human sTRAIL Receptor-1 Protein |
PROTO00220-1 |
BosterBio |
50ug |
EUR 317 |
Description: TRAIL Receptor-1/DR4 and TRAIL Receptor-2/DR5 belong to the TNFR superfamily of transmembrane proteins and contain a cytoplasmic "death domain, " which can activate the cell's apoptotic machinery. These receptors are activated by binding to either membrane anchored or soluble TRAIL/Apo2L. Recombinant human soluble TRAIL Receptor-1/DR4 is a 22.7 kDa protein (215 amino acid residues) consisting of the TNFR homologous, cysteine rich portion of the extracellular domain. |
JE (MCP-1), murine recombinant protein |
P1034-1 |
ApexBio |
1 mg |
EUR 3878 |
Description: JE (MCP-1), also known as chemokine (C-C motif) ligand 2 (CCL2), is a member of the CC chemokine family that is a chemotactic agent for mononuclear cells. |
IFN-alpha 1, human recombinant protein |
P1058-.1 |
ApexBio |
100 µg |
EUR 313 |
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues. |
IFN-alpha 1, human recombinant protein |
P1058-1 |
ApexBio |
1 mg |
EUR 2277 |
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues. |
The pathways of pyrimidine metabolism and biosynthesis of unsaturated fatty acids had been enriched each in the rumen fluid and milk. We additionally discovered the milk 2-hydroxycaprylic acid was positively correlated with ruminal uridine 5-monophosphate, and was negatively correlated with ruminal deoxycytidine, and the milk thymidine was positively correlated with ruminal icosenoic acid. This examine discovered that the supplementation of PFL may alter the ruminal metabolic profiles and milk synthesis via regulation of the pathways of pyrimidine metabolism and biosynthesis of unsaturated fatty acids. Our new findings present complete insights into the metabolomics profile of rumen fluid and milk, supporting the potential manufacturing of Perilla frutescens milk in dairy cows.