Distribution of free and bound phenolic compounds, and alkylresorcinols in wheat aleurone enriched fractions

Several firms have centered their consideration on the event of applied sciences capable of enrich/isolate the wheat aleuronic layer as a result of it’s a supply of bioactive compounds. In this work two completely different wheat bran fractions enriched in aleurone (AF1, 55-70% aleurone and AF2, 75-90% aleurone) had been obtained by a dry fractionation primarily based on air classification. Free and bound phenolic compounds, and alkylresorcinols had been decided in the 2 fractions by HPLC-DAD-ESI-TOF-MS and GC-MS, respectively. To our information, feruloyl di-hexoside was described for the primary time in wheat aleurone and flavonoids had been quantified for the primary time in this fraction. The outcomes have proven that essentially the most concentrated free phenolic compounds had been flavonoids, and AF1 was the fraction that introduced the very best flavonoid content material; whereas trans ferulic acid was essentially the most plentiful bound phenolic acid, which highest content material was obtained in AF2.

Besides, whole content material of ferulic acid monomers in AF2 was 33.63% greater than in AF1, whereas whole content material of ferulic acid dimers/trimers in AF1 was 33.9% greater than in AF2. The highest content material of alkylresorcinols was obtained in AF1 and it was 10.30% greater than the obtained in AF2. Therefore, it may be said that this inexperienced know-how could possibly be used to provide enriched aleurone fractions as supply of phenolic and alkylresorcinol compounds. These fractions could possibly be of nice curiosity for the formulation of enriched meals.Current consciousness about the advantages of a balanced food regimen helps ongoing developments in people in direction of a more healthy food regimen. This evaluation supplies an outline of fruits and fruit-by merchandise as sources of bioactive compounds and their extraction methods, and the use of lactic acid fermentation of fruit juices to extend their performance.

Fruit matrices emerge as a technological different to be fermented by autochthonous or allochthonous lactic acid micro organism (LAB similar to Lactiplantibacillus plantarum, Lacticaseibacillus rhamnosus, and different Lactobacillus species), and additionally as probiotic automobiles. During fermentation, microbial enzymes act on a number of fruit phytochemicals producing new derived compounds with affect on the aroma and the performance of the fermented drinks. Moreover, fermentation considerably reduces the sugar content material bettering their dietary worth and extending the shelf-life of fruit-based drinks.

Biopolymers and nanostructured supplies to develop pectinases-based immobilized nano-biocatalytic techniques for biotechnological functions

Pectinases are the rising enzymes of the biotechnology business with a 25% share in the worldwide meals and beverage enzyme market. These are inexperienced and eco-friendly instruments of nature and maintain a outstanding place among the many commercially produced enzymes. Pectinases exhibit functions in varied industrial bioprocesses, similar to clarification of fruit juices and wine, degumming, and retting of plant fibers, extraction of antioxidants and oil, fermentation of tea/espresso, wastewater remediation, modification of pectin-laden agro-industrial waste supplies for high-value merchandise biosynthesis, manufacture of cellulose fibres, scouring, bleaching, and measurement discount of material, cellulosic biomass pretreatment for bioethanol manufacturing, and so forth. Nevertheless, like different enzymes, pectinases additionally face the challenges of low operational stability, recoverability, and recyclability.

To tackle the above-mentioned issues, enzyme immobilization has grow to be an eminently promising strategy to enhance their thermal stability and catalytic traits. Immobilization facilitates simple restoration and recycling of the biocatalysts a number of instances, resulting in enhanced efficiency and business feasibility.In this evaluation, we illustrate current developments on the immobilization of pectinolytic enzymes utilizing polymers and nanostructured materials-based provider helps to represent novel biocatalytic techniques for industrial exploitability.

The first part reviewed the immobilization of pectinases on polymers-based helps (ca-alginate, chitosan, agar-agar, hybrid polymers) as a number matrix to assemble strong pectinases-based biocatalytic techniques. The second half covers nanostructured helps (nano-silica, magnetic nanostructures, hybrid nanoflowers, dual-responsive polymeric nanocarriers, montmorillonite clay), and cross-linked enzyme aggregates for enzyme immobilization. The biotechnological functions of the resulted immobilized strong pectinases-based biocatalytic techniques are additionally meticulously vetted. Finally, the concluding remarks and future suggestions are additionally given.

 Distribution of free and bound phenolic compounds, and alkylresorcinols in wheat aleurone enriched fractions

Untargeted metabolomic examine milk and ruminal fluid of Holstein cows supplemented with Perilla frutescens leaf

Milk compounds are vital for human nutrient necessities and well being. The ruminal metabolic profile is liable for dietary diet and determines milk manufacturing. Perilla frutescens leaf (PFL) is a generally used medicinal herb resulting from its bioactive metabolites. This examine elucidated the results of PFL on the metabolome of two biofluids (rumen fluid and milk) of 14 cows fed a primary whole blended ration food regimen (CON, n = 7) and supplemented with 300 g/d PFL per cow (PFL, n = 7) by ultra-performance liquid chromatography coupled to quadrupole time-of-flight mass spectrometry. Milk PE-NMe and DG, oleanolic acid, and nucleotides had been upregulated, and milk medium-chain fatty acids (2-hydroxycaprylic acid) had been down-regulated in response to PFL. The supplementation of PFL elevated the abundance of pyrimidine nucleotides each in rumen fluid and milk.

Rat/Canine Angiotensin I, pure (bioactive)

AT56-P-1 1 mg
EUR 286

DiscoveryProbe? Bioactive Compound Library

L1022-.25 250 uL/well(10 mM solution)
EUR 42042

DiscoveryProbe? Bioactive Compound Library

L1022-5 5 mg/well
EUR 54686

Human Angiotensin II (1-4), pure (bioactive)

AT66-P-5 5 mg
EUR 286

Human Angiotensin I, pure (bioactive)

AT55-P-5 5 mg
EUR 529

Human Angiotensin II, pure (bioactive)

AT65-P-5 5 mg
EUR 286

Human Angiotensin III, pure (bioactive)

AT75-P-5 5 mg
EUR 286

GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein

PROTP01275-1 Regular: 50ug
EUR 317
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.

HIV-1 Tat Protein Peptide

B1433-1 1 mg
EUR 128
Description: HIV-1 Tat Protein Peptide

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 276

Lytic Peptide, Shiva ? 1

SP-88327-1 1 mg
EUR 347

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

YAP-TEAD Inhibitor 1 (Peptide 17)

A1149-1 1 mg
EUR 235

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 518

Human Angiotensin II (3-8), pure (bioactive)

AT67-P-5 5 mg
EUR 286

Human Angiotensin II (4-8), pure (bioactive)

AT68-P-5 5 mg
EUR 286

Human Angiotensin II (5-8), pure (bioactive)

AT69-P-5 5 mg
EUR 286

ENTPD3 Human, Ectonucleoside Triphosphate Diphosphohydrolase 3 Human Recombinant Protein, sf9 Bioactive

PROTO75355-2 Regular: 4ug
EUR 317
Description: ENTPD3 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 451 amino acids (44-485a.a.) and having a molecular mass of 50.7kDa (Molecular size on SDS-PAGE will appear at approximately 50-70kDa).;ENTPD3 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.

GnRH Associated Peptide (GAP) (1-13), human

A1020-1 1 mg
EUR 90
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

Rhodopsin peptide

A1087-1 1 mg
EUR 131
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light.

SAMS Peptide

B5097-1 1 mg
EUR 222

Human Hepcidine-25 bioactive(Hepc-25) ELISA Kit

QY-E05472 96T
EUR 361

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-48T 48T
EUR 527
  • Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-96T 96T
EUR 688
  • Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-48T 48T
EUR 398
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-96T 96T
EUR 511
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-48T 48T
EUR 450
  • Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-96T 96T
EUR 582
  • Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-48T 48T
EUR 467
  • Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-96T 96T
EUR 605
  • Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-48Tests 48 Tests
EUR 557

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-96Tests 96 Tests
EUR 774

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-48Tests 48 Tests
EUR 404

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-96Tests 96 Tests
EUR 556

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-48Tests 48 Tests
EUR 465

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-96Tests 96 Tests
EUR 643

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-48Tests 48 Tests
EUR 486

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-96Tests 96 Tests
EUR 672

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-48Tests 48 Tests
EUR 533

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-96Tests 96 Tests
EUR 740

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-48Tests 48 Tests
EUR 387

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-96Tests 96 Tests
EUR 532

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-48Tests 48 Tests
EUR 446

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-96Tests 96 Tests
EUR 615

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-48Tests 48 Tests
EUR 465

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-96Tests 96 Tests
EUR 643

Atrial Natriuretic Peptide (1-28), Rat

SP-55278-1 0.5 mg
EUR 286

C-type natriuretic peptide (1-22) (human, rat, swine)

B5441-1 1 mg
EUR 276

Cadherin Peptide, avian

A1028-1 1 mg
EUR 102
Description: Cadherin Peptide, avian, (C44H75N17O13), a peptide with the sequence Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-NH2, MW= 1050.2. Cadherins (named for "calcium-dependent adhesion") are a class of type-1 transmembrane proteins.

Dynamin inhibitory peptide

A1046-1 1 mg
EUR 189
Description: Dynamin Inhibitory Peptide is a peptide (Gln-Val-Pro-Ser-Arg-Pro-Asn-Arg-Ala-Pro) inhibitor of the GTPase dynamin.Dynamin is a 100-kDa large GTPase that functions to tabulate membranes and liberate nascent vesicles from the Golgi apparatus and plasma membrane.

Eledoisin-Related Peptide

B5233-1 1 mg
EUR 155

MLCK inhibitor peptide

B5236-1 1 mg
EUR 184

Lyn peptide inhibitor

B5285-1 1 mg
EUR 601

Compstatin control peptide

B5478-1 1 mg
EUR 373

Histone H2A Peptide

7145-1
EUR 175

Histone H2B Peptide

7146-1
EUR 175

c-JUN peptide

B9007-1 1 mg
EUR 312

DAPK Substrate Peptide

A4469-1 1 mg
EUR 292
Description: Synthetic peptide substrate for death associated protein kinase (DAPK) (Km = 9 ?M).

Calcineurin Autoinhibitory Peptide

A4532-1 1 mg
EUR 399
Description: Selective inhibitor of Ca2+-calmodulin-dependent protein phosphatase (calcineurin) (IC50 ~ 10 mM). Does not inhibit PP1, PP2A or CaM kinase II (IC50 > 100 mM).

IGF-1, human recombinant

P1016-.1 100 µg
EUR 763
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue

Gastrin Releasing Peptide (GRP) (1-16) (porcine)

SP-100261-1 1 mg
EUR 164

Human LILRB4/ CD85k/ ILT3 Bioactive Protein, Fc, Human-100ug

QP2848-100ug 100ug
EUR 563

Human LILRB4/ CD85k/ ILT3 Bioactive Protein, His, Yeast-20ug

QP2848-20ug 20ug
EUR 245

Human/Rat/Mouse PLP104-117 peptide, depalmitoylated

PLP104-1-1 1 mg
EUR 141

Human/Rat/Mouse PLP178-191 peptide, depalmitoylated

PLP178-1-1 1 mg
EUR 141

Human/Rat/Mouse PLP40-59 peptide, depalmitoylated

PLP40-1-1 1 mg
EUR 141

Rat renin inhibitor peptide

2557-1
EUR 229

Akt/SKG Substrate Peptide

B5101-1 1 mg
EUR 350

MLCK inhibitor peptide 18

B5211-1 1 mg
EUR 116

PDZ1 Domain inhibitor peptide

B5271-1 1 mg
EUR 438

Urotensin II-related peptide

B5272-1 1 mg
EUR 273

G-Protein antagonist peptide

B6889-1 1 mg
EUR 366

Thrombin Receptor Agonist Peptide

A8668-1 1 mg
EUR 200
Description: Agonist at the thrombin receptor; causes platelet aggregation (EC50 = 4 ?M) and secretion.

Calcitonin, Human (Synthetic peptide)

P1433-1
EUR 185

IL-1 beta, rat recombinant

P1019-1 1 mg
EUR 7288
Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties.

ApoA-1, human recombinant protein

P1052-.1 100 µg
EUR 313
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

ApoA-1, human recombinant protein

P1052-1 1 mg
EUR 1553
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

WNT-1, human recombinant protein

P1068-1 1 mg
EUR 6940
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Recombinant Human ANG-1 Protein

PROTQ15389-1 20ug
EUR 317
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.

Recombinant Murine Cardiotrophin-1 Protein

PROTQ60753-1 10ug
EUR 317
Description: CT-1 is a member of the IL-6 family of cytokines which also includes LIF, CNTF, OSM (Oncostatin M), IL-11, IL-6 and possibly NNT-1/BCSF-3. CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung and signals through the LIF receptor and the gp130 receptor subunit. CT-1 has the ability to induce cardiac myocyte hypertrophy, and enhances the survival of cardiomyocyte and different neuronal populations. Recombinant murine Cardiotrophin-1 is a 21.3 kDa protein consisting of 202 amino acid residues.

Recombinant Human Gremlin-1 Protein

PROTO60565-1 50ug
EUR 317
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle.  Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7.  It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3  kDa protein containing 160 amino acid residues.

Recombinant Human Galectin-1 Protein

PROTP09382-1 50ug
EUR 317
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.

Recombinant Human PECAM-1 Protein

PROTP16284-1 50ug
EUR 317
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions

Canine IGF-1 Recombinant Protein

R00148-1 5ug/vial
EUR 259
Description: Insulin-like growth factor 1 (IGF-1) is a primary mediator of the effects of growth hormone (GH) and has growth-promoting effects on almost every cell in the body. IGF-1 can also regulate cell growth and development, especially in nerve cells, as well as cellular DNA synthesis. Canine IGF-1 Recombinant Protein is purified insulin-like growth factor 1 (IGF-1) produced in yeast.

RFDS peptide

SP-52304-1 5 mg
EUR 141

RGD peptide

SP-52305-1 5 mg
EUR 164

RGDV peptide

SP-52307-1 5 mg
EUR 141

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein

P1054-1 1 mg
EUR 3947
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

Human/Rat/Mouse PLP139-151 (S140) peptide, depalmitoylated

PLP139-1-1 1 mg
EUR 141

IL-1-beta Interleukin-1 betaHuman Recombinant Protein

PROTP01584-1 Regular: 10ug
EUR 317
Description: Interleukin-1 beta Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17000 Dalton.;The IL-1b is purified by proprietary chromatographic techniques.

MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein

PROTP03956-1 Regular: 20ug
EUR 317
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.

(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein

PROTO75771-1 Regular: 10ug
EUR 317
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

OryzaExp? IGF-1 LR3, Human Recombinant

P1399-1
EUR 881

JE (MCP-1), murine recombinant protein

P1034-1 1 mg
EUR 3878
Description: JE (MCP-1), also known as chemokine (C-C motif) ligand 2 (CCL2), is a member of the CC chemokine family that is a chemotactic agent for mononuclear cells.

IFN-alpha 1, human recombinant protein

P1058-.1 100 µg
EUR 313
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.

IFN-alpha 1, human recombinant protein

P1058-1 1 mg
EUR 2277
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.

The pathways of pyrimidine metabolism and biosynthesis of unsaturated fatty acids had been enriched each in the rumen fluid and milk. We additionally discovered the milk 2-hydroxycaprylic acid was positively correlated with ruminal uridine 5-monophosphate, and was negatively correlated with ruminal deoxycytidine, and the milk thymidine was positively correlated with ruminal icosenoic acid. This examine discovered that the supplementation of PFL may alter the ruminal metabolic profiles and milk synthesis via regulation of the pathways of pyrimidine metabolism and biosynthesis of unsaturated fatty acids. Our new findings present complete insights into the metabolomics profile of rumen fluid and milk, supporting the potential manufacturing of Perilla frutescens milk in dairy cows.